PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00948.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family ARF
Protein Properties Length: 620aa    MW: 67869.8 Da    PI: 7.1413
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00948.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.94.4e-24166267199
                              EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEE CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvv 81 
                              f+k+lt sd++++g +++p++ ae++       +++ s++l  +d++g +W++++iyr++++r++lt+GW+ Fv+ ++L +gD v+
  Rsa1.0_00948.1_g00004.1 166 FCKTLTASDTSTHGGFSVPRRAAEDCfppldYTQPRPSQELLARDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVL 251
                              99****************************9444566789********************************************** PP

                              EEE-SSSEE..EEEEE-S CS
                       B3  82 Fkldgrsefelvvkvfrk 99 
                              F   + ++++l+++v+r+
  Rsa1.0_00948.1_g00004.1 252 FL--RGDDGKLRLGVRRA 267
                              **..3489999****997 PP

2Auxin_resp112.63.9e-37292373182
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                              +aha+st+++F+++YnP+as+s+F++++ k++k+++ ++++GmRfk ++e+ed+serr  G+++g+++ldp+rWp+SkWr+L
  Rsa1.0_00948.1_g00004.1 292 VAHAISTNTAFNIYYNPKASWSNFIIPAPKFLKTVDYPFCIGMRFKARVESEDASERRSPGIITGINELDPIRWPGSKWRCL 373
                              79*******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-42156288IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.9E-39161275IPR015300DNA-binding pseudobarrel domain
CDDcd100171.09E-21164266No hitNo description
SMARTSM010192.2E-22166268IPR003340B3 DNA binding domain
PfamPF023626.0E-22166267IPR003340B3 DNA binding domain
PROSITE profilePS5086313.296166268IPR003340B3 DNA binding domain
PfamPF065075.0E-31292373IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0010582Biological Processfloral meristem determinacy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MGGLIDLNVT EEEEKERTTP SSGSGSGSLS PCDSSSSASA FGGVSGSSST RSSSGEVCLE  60
LWHACAGPLI SLPKRGSLVL YFPQGHLEQA PDFSAAIYGL PPHVFCRILD VKLHAETATD  120
EVYAQVSLLP ESEDIERKVR EGVIGVDGGD QEDYEVLKRT NTPHMFCKTL TASDTSTHGG  180
FSVPRRAAED CFPPLDYTQP RPSQELLARD LHGLEWRFRH IYRGQPRRHL LTTGWSAFVN  240
KKKLVSGDAV LFLRGDDGKL RLGVRRASQI EDASAFSSQY NQNMNHNNFA EVAHAISTNT  300
AFNIYYNPKA SWSNFIIPAP KFLKTVDYPF CIGMRFKARV ESEDASERRS PGIITGINEL  360
DPIRWPGSKW RCLLVRWDDI EANGHHQQRL SPWEIEPSGS ISSSGSFITT GPKRSRIGSD  420
IPVSQGIRST DFEESLRFQR VLQGQEIFHG GFINTSSDGG AGARRGKFKG AEFGDSYGGF  480
HKVLQGQETV PAYPMMTDHH HRQHQGMMMM SQRNIWCGPF QNFSTRILPP SSVHVSSSSS  540
APSSGGPNAR LEEQHHGGSG RCRLFGFPLR DEATAVVGPC VEGGQNGSSI RGGGGSAGVQ  600
SNHHGRDIYG MRDMLLDIAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1085440416361Auxin response factor 1
4ldw_A1e-1085440416361Auxin response factor 1
4ldw_B1e-1085440416361Auxin response factor 1
4ldx_A1e-1085440416361Auxin response factor 1
4ldx_B1e-1085440416361Auxin response factor 1
4ldy_A1e-1085440416361Auxin response factor 1
4ldy_B1e-1085440416361Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00021PBMTransfer from AT2G33860Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794620.0JN979462.1 Brassica rapa subsp. pekinensis auxin response factor 3-1 (ARF3-1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013631127.10.0PREDICTED: auxin response factor 3-like
SwissprotO236610.0ARFC_ARATH; Auxin response factor 3
TrEMBLA0A0D3BSB50.0A0A0D3BSB5_BRAOL; Auxin response factor
STRINGBra005465.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49242849
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33860.10.0ARF family protein